107,736 Free Images of Img

cc-zeropages with mapsfiles by christoph braunuploaded with lrmediawikiplantsreptileswanfrieder weihnachtsmarkt 2016naturefiles uploaded by sic19449. wanfrieder vogelschießen
Beja merece+ em Lisboa IMG 3049 (42034757171)
peoplecity
Beja merece+ em Lisboa IMG 3058 (41990409962)
peoplecity
Cup with two crocodiles and a boat-MAHG D 1183-IMG 9787-white
cup with two crocodiles and a boat-mahg d 1183
Padibastet before a shrine of Imhotep-E 5784-IMG 2198
aircraftvehicle
Woman auxiliary of the pigeon service of the Swiss Army at MGG-IMG 0106-white
woman auxiliary of the pigeon service of the swiss army at mgg
Woman auxiliary of the pigeon service of the Swiss Army at MGG-IMG 0104-white
woman auxiliary of the pigeon service of the swiss army at mgg
Woman auxiliary of the pigeon service of the Swiss Army at MGG-IMG 0106-gradient
woman auxiliary of the pigeon service of the swiss army at mgg
Lion leg shaped furniture element-MAHG 023457-IMG 1751-gradient
lion leg shaped furniture element-mahg 023457
Cornus hybrid IMG 0287-1
plantsflower
Crocodile Crocodylus niloticus IMG 6966
self-published workreptiles
Beersheba IMG 1130
self-published worktown
Arctotis fastuosa-IMG 6967
natureplants
Arctotis fastuosa-IMG 6966
natureplants
Arctotis fastuosa-IMG 6978
natureplants
Double Cassette Tape Recorder IMG 0397
pages with mapsboombox
Ebford 2021-03-21 IMG 01
self-published workpages with maps
Ebford 2021-03-21 IMG 03
self-published workpages with maps
Ebford 2021-03-21 IMG 04
self-published workpages with maps
Ein Avdat IMG 1234
adventurerock
Noise reduction IMG 0363
pages with mapslight
IMG 20170712-100422-podgorica-airport-july-2017
self-published workcc-zero
Jade Plant, Crassula ovata IMG 3630
natureplants
Harold Montgomery Road sign, Webster Parish, LA IMG 2510
self-published workcc-zero
Shoreline Park Mountain View California IMG 2682
self-published workwater
Smoke tree Cotinus coggygria IMG 3152
naturetree
Robbins Cemetery - Lexington, MA - IMG 1899
self-published workarchitecture
Shoreline Park Mountain View California IMG 2646
self-published workwater
Powderham 2021-04-08 IMG 06
self-published workpowderham
Ramot Beersheva IMG 0913a
self-published workpages with maps
Ramot (Beersheba) IMG 5406
self-published workpages with maps
The Flintstones Bedrock City IMG 0132
self-published workcc-zero
The Australian Solder Park Beersheba IMG 0736
self-published workpages with maps
Mexican Firebush Hamelia patens-IMG 6012
san antonio botanical gardenhamelia patens
GLAMcamp London, England, GB, IMG 5036 edit
files by christoph braunself-published work
Trachemys scripta elegans IMG 7459-4
reptilesanimals
Trachemys scripta elegans IMG 7419-2
reptilesanimals
Trachemys scripta elegans IMG 7462-2
reptilesanimals
Trachemys scripta elegans IMG 7365-2
reptilesanimals
Trachemys scripta elegans IMG 7367-2
reptilesanimals
Trachemys scripta elegans IMG 7487-2
reptilesanimals
Wanfrieder Weihnachtsmarkt 2016 IMG 2911 edit
files by christoph braunred
Wanfrieder Weihnachtsmarkt 2016 IMG 2878 edit
files by christoph brauntown
Wanfrieder Weihnachtsmarkt 2016 IMG 3039 edit
files by christoph braunfood
Walter - Stein - IMG 2088 v1
self-published workletter
Exeter 2020-12-20 IMG 27
self-published worktown
Exeter 2020-12-20 IMG 28
self-published worktown
449. Wanfrieder Vogelschießen 2017 IMG 5055 edit
449. wanfrieder vogelschießenfiles by christoph braun
449. Wanfrieder Vogelschießen 2017 IMG 5054 edit
449. wanfrieder vogelschießenfiles by christoph braun
449. Wanfrieder Vogelschießen 2017 IMG 4625 edit
449. wanfrieder vogelschießenfiles by christoph braun
449. Wanfrieder Vogelschießen 2017 IMG 4612 edit
449. wanfrieder vogelschießenfiles by christoph braun
Manihot esculenta 'Variegata' IMG 5668
san antonio botanical gardenself-published work
Negev Zoo Snake IMG 1083
self-published workreptiles
Negev Zoo IMG 0988
self-published workarchitecture
Exminister 2021-04-03 IMG 10
self-published worklawn
Exeter 2020-12-20 IMG 24
sidewalktown
Exeter Library 2020-12-30 IMG 17
self-published workpages with maps
Exeter 2020-12-20 IMG 10
trafficcar
Exeter 2020-12-20 IMG 15
self-published workpages with maps
Exeter 2020-11-01 IMG 04
self-published workpages with maps
Exeter 2020-11-01 IMG 47
self-published workpages with maps
Exeter 2020-12-20 IMG 01
citytown
Exeter 2020-11-01 IMG 13
self-published workpages with maps
Exeter 2020-11-01 IMG 10
self-published workpages with maps
Ein Avdat IMG 1237
landscapewater
Exton 2021-03-21 IMG 04
villagetown
Fragaria × ananassa IMG 3027
plantsfood
Australian pine tree Shoreline Park Mountain View California IMG 2883
self-published worktree
Arctotis fastuosa-IMG 6979
natureplants
Arctotis fastuosa-IMG 6976
natureplants
BeerSheba IMG 5767
self-published workgrass
Beersheva IMG 0712
self-published workpages with maps
Exeter 2020-12-20 IMG 29
sidewalkcity
Wanfrieder Weihnachtsmarkt 2016 IMG 2963 edit
lightnight
449. Wanfrieder Vogelschießen 2017 IMG 4894 edit
files by christoph braunpeople
449. Wanfrieder Vogelschießen 2017 IMG 4622 edit
files by christoph braungroup
449. Wanfrieder Vogelschießen 2017 IMG 4641 edit
files by christoph brauncelebrities
449. Wanfrieder Vogelschießen 2017 IMG 5332 edit
files by christoph braunlawn
449. Wanfrieder Vogelschießen 2017 IMG 4890 edit
files by christoph braunpeople
449. Wanfrieder Vogelschießen 2017 IMG 4505 edit
files by christoph braunarchitecture
Sunflowers public domain helianthus annuus IMG 1172
natureplants
Wanfrieder Weihnachtsmarkt 2016 IMG 2925 edit
shoppingpeople
Wanfrieder Weihnachtsmarkt 2016 IMG 2924 edit
shoppingpeople
Wanfrieder Weihnachtsmarkt 2016 IMG 3132 edit
lowlightpeople
Wanfrieder Weihnachtsmarkt 2016 IMG 3069 edit
nighttree
Wanfrieder Weihnachtsmarkt 2016 IMG 3119 edit
lightnight
Wanfrieder Weihnachtsmarkt 2016 IMG 3089 edit
celebritieslight
Wanfrieder Weihnachtsmarkt 2016 IMG 3073 edit
lightcity
ZOO נגב ZOO IMG 0969
vehiclecar
Trachemys scripta elegans IMG 7364-2
reptilesanimals
Trachemys scripta elegans IMG 7448-2
reptilesanimals
Trachemys scripta elegans IMG 7366-4
reptilesanimals
Walter - Rathaus- 5 - IMG 2090 v1
self-published worktown
Woodbury Salterton 2021-04-05 IMG 01
self-published worksky
Angela Merkel IMG 4162 edit
women with black backgroundangela merkel
Grand Canyon, South Rim IMG 4621
landscapemountain
GLAMcamp London, England, GB, IMG 5075 edit
self-published workgroup
IMG 0096 Foot Switch
accessible input devicespages with maps
IMG 2597 Abelia × grandiflora
naturespring
Longstreet, LA, Baptist Church IMG 6249
baptist churches in louisianaself-published work
Magnolia-grandiflora-IMG 7157
plantsleaf
3601 - 3700 of 107,736 Next page
/ 1078